Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWI SETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIP RPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGS ELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIV CQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVK QRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKY PGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDE GGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQ IENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMA ARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQT LLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
    • Molecular weight
      94 kDa including tags
    • Amino acids
      1 to 599

Specifications

Our Abpromise guarantee covers the use of ab131962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2' 5' oligoadenylate binding protein
    • 2''-5''-oligoadenylate-binding protein
    • 2'5' oligoadenylate binding protein
    • ABC 38
    • ABC38
    • ABCE 1
    • ABCE1
    • ABCE1_HUMAN
    • ATP binding cassette sub family E (OABP) member 1
    • ATP binding cassette sub family E member 1
    • ATP-binding cassette sub-family E member 1
    • HuHP 68
    • HuHP68
    • OABP
    • Ribonuclease 4 inhibitor
    • Ribonuclease L (2' 5' oligoisoadenylate synthetase dependent) inhibitor
    • Ribonuclease L (2'5' oligoisoadenylate synthetase dependent) inhibitor
    • Ribonuclease L inhibitor
    • RLI
    • RNase L inhibitor
    • RNASEL1
    • RNASELI
    • RNS 4I
    • RNS4I
    see all
  • Function
    Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. May act as a chaperone for post-translational events during HIV-1 capsid assembly.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCE family.
    Contains 2 4Fe-4S ferredoxin-type domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Cytoplasm. Mitochondrion. Localized to clusters of virus formation at the plasma membrane.
  • Information by UniProt

Recombinant Human ABCE1 protein images

  • 12.5% SDS-PAGE analysis of ab131962 stained with Coomassie Blue.

References for Recombinant Human ABCE1 protein (ab131962)

ab131962 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab131962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up