Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWI SETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIP RPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGS ELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIV CQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVK QRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKY PGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDE GGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQ IENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMA ARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQT LLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
    • Molecular weight
      94 kDa including tags
    • Amino acids
      1 to 599

Specifications

Our Abpromise guarantee covers the use of ab131962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2' 5' oligoadenylate binding protein
    • 2''-5''-oligoadenylate-binding protein
    • 2'5' oligoadenylate binding protein
    • ABC 38
    • ABC38
    • ABCE 1
    • ABCE1
    • ABCE1_HUMAN
    • ATP binding cassette sub family E (OABP) member 1
    • ATP binding cassette sub family E member 1
    • ATP-binding cassette sub-family E member 1
    • HuHP 68
    • HuHP68
    • OABP
    • Ribonuclease 4 inhibitor
    • Ribonuclease L (2' 5' oligoisoadenylate synthetase dependent) inhibitor
    • Ribonuclease L (2'5' oligoisoadenylate synthetase dependent) inhibitor
    • Ribonuclease L inhibitor
    • RLI
    • RNase L inhibitor
    • RNASEL1
    • RNASELI
    • RNS 4I
    • RNS4I
    see all
  • Function
    Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. May act as a chaperone for post-translational events during HIV-1 capsid assembly.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCE family.
    Contains 2 4Fe-4S ferredoxin-type domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Cytoplasm. Mitochondrion. Localized to clusters of virus formation at the plasma membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131962 stained with Coomassie Blue.

References

ab131962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up