Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRET TEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQEL LSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTRE MPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELD ADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFML LLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHN KKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSA KLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQN VSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPT DGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKII GRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIE TIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILA YKEHLKSKLVDEEPQLTKRTHNV
    • Amino acids
      1 to 623
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0710005O05Rik
    • ABC28
    • ABCF 2
    • ATP binding cassette sub family F (GCN20) member 2
    • DKFZp586K1823
    • Drr3
    • E430001O06
    • EST133090
    • fb04f06
    • fc74f03
    • fd58d07
    • HUSSY 18
    • MABC1
    • MGC128735
    • MGC53054
    • wu:fb04f06
    • wu:fc74f03
    • wu:fd58d07
    see all
  • Relevance
    ABCF 2 is a member of the ABC Transporter superfamily and of the GCN20 subfamily. As a member of the ABC Transporter family, it functions to transport various molecules across extra- and intracellular membranes.

Images

  • ab160792 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up