Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLN GHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTL LKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMKGAVLINGLPR DLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEI LTALGLLSCANTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSA SCFQVVSLMKGLAQGGRSIICTIHQPSAKLFELFDQLYVLSQGQCVYRGK VCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCD SDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSAS CLTQFCILFKRTFLSIMRDSVLTHLRITSHIGIGLLIGLLYLGIGNEAKK VLSNSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLNYWYSLKAYYL AKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAALGTMTSLVAQS LGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYIS YVRYGFEGVILSIYGLDREDLHCDIDETCHFQKSEAILRELDVENAKLYL DFIVLGIFFISLRLIAYFVLRYKIRAER
    • Amino acids
      1 to 678
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABC transporter 8
    • ABC8
    • ABCG1
    • ABCG1_HUMAN
    • ATP-binding cassette sub family G member 1
    • ATP-binding cassette sub-family G member 1
    • ATP-binding cassette transporter 8
    • ATP-binding cassette transporter member 1 of subfamily G
    • ATP-binding cassette, sub family G WHITE member 1
    • homolog of Drosophila white
    • MGC34313
    • White protein homolog
    • White protein homolog ATP binding cassette transporter 8
    • WHITE1
    • WHT1
    see all
  • Function
    Transporter involved in macrophage lipid homeostasis. Is an active component of the macrophage lipid export complex. Could also be involved in intracellular lipid transport processes. The role in cellular lipid homeostasis may not be limited to macrophages.
  • Tissue specificity
    Expressed in several tissues. Expressed in macrophages; expression is increased in macrophages from patients with Tangier disease.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily.
    Contains 1 ABC transmembrane type-2 domain.
    Contains 1 ABC transporter domain.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane. Predominantly localized in the intracellular compartments mainly associated with the endoplasmic reticulum (ER) and Golgi membranes.
  • Information by UniProt

Images

  • ab153003 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up