Recombinant Human ABHD12B protein (denatured) (ab181894)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMLGIWHTVPSCRGEDAKGKDCCWYEAA LRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTG KPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKG CPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFP NDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIF PPGFQHNLLCKSPTLLITVRDFLSKQWS
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 255
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab181894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • AB12B_HUMAN
    • ABHD12B
    • Abhydrolase domain containing 12B
    • Abhydrolase domain-containing protein 12B
    • Bem46l3
    • c14_5314
    • C14orf29
    • Gm804
    see all
  • Sequence similarities
    Belongs to the serine esterase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab181894.

References

ab181894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up