Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATV FGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELK RNTLYFSTDV
    • Amino acids
      750 to 859
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • abr
    • ABR_HUMAN
    • Active BCR related
    • Active BCR related gene
    • Active breakpoint cluster region related protein
    • Active breakpoint cluster region-related protein
    • MDB
    see all
  • Function
    GTPase-activating protein for RAC and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them.
  • Tissue specificity
    Highly enriched in the brain. Much weaker expression in heart, lung and muscle.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 Rho-GAP domain.
  • Information by UniProt

Images

  • ab157827 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up