Overview

  • Product nameRecombinant Human ACAA1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP09110
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLSGAPQASAADVVVVHGRRTAICRAGRGG FKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQ FLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSL ADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALA SQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTME GLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLR SYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYC VEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVV SMCIGTGMGAAAVFEYPGN
    • Molecular weight44 kDa
    • Amino acids27 to 424
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab98236 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 3 ketoacyl CoA thiolase peroxisomal
    • 3-ketoacyl-CoA thiolase
    • ACAA
    • ACAA1
    • Acetyl CoA acyltransferase 1
    • Acetyl Coenzyme A acyltransferase 1
    • Acetyl-CoA acyltransferase
    • Acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3 oxoacyl Coenzyme A
    • Beta ketothiolase
    • Beta-ketothiolase
    • peroxisomal
    • Peroxisomal 3 oxoacyl CoA thiolase
    • Peroxisomal 3 oxoacyl Coenzyme A thiolase
    • Peroxisomal 3-oxoacyl-CoA thiolase
    • PTHIO
    • THIK_HUMAN
    • THIO
    see all
  • PathwayLipid metabolism; fatty acid metabolism.
  • Sequence similaritiesBelongs to the thiolase family.
  • Cellular localizationPeroxisome.
  • Information by UniProt

Recombinant Human ACAA1 protein images

  • 15% SDS-PAGE analysis of 3µg ab98236

References for Recombinant Human ACAA1 protein (ab98236)

ab98236 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"