Overview

  • Product name
    Recombinant Human ACAA1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLSGAPQASAADVVVVHGRRTAICRAGRGG FKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQ FLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSL ADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALA SQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTME GLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLR SYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYC VEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVV SMCIGTGMGAAAVFEYPGN
    • Molecular weight
      44 kDa
    • Amino acids
      27 to 424
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab98236 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 3 ketoacyl CoA thiolase peroxisomal
    • 3-ketoacyl-CoA thiolase
    • ACAA
    • ACAA1
    • Acetyl CoA acyltransferase 1
    • Acetyl Coenzyme A acyltransferase 1
    • Acetyl-CoA acyltransferase
    • Acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3 oxoacyl Coenzyme A
    • Beta ketothiolase
    • Beta-ketothiolase
    • peroxisomal
    • Peroxisomal 3 oxoacyl CoA thiolase
    • Peroxisomal 3 oxoacyl Coenzyme A thiolase
    • Peroxisomal 3-oxoacyl-CoA thiolase
    • PTHIO
    • THIK_HUMAN
    • THIO
    see all
  • Pathway
    Lipid metabolism; fatty acid metabolism.
  • Sequence similarities
    Belongs to the thiolase family.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98236

References

ab98236 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up