Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFN DEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNA SGVADGAGAV
    • Amino acids
      151 to 260
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 ketoacyl CoA thiolase
    • 3 ketoacyl CoA thiolase mitochondrial
    • 3-ketoacyl-CoA thiolase, mitochondrial
    • 3-oxoacyl-CoA thiolase, mitochondrial
    • ACAA 2
    • Acaa2
    • Acetyl CoA acyltransferase
    • Acetyl CoA acyltransferase 2
    • Acetyl Coenzyme A acyltransferase 2
    • Acetyl-CoA acyltransferase
    • Beta ketothiolase
    • Beta-ketothiolase
    • DSAEC
    • Mitochondrial 3 oxoacyl CoA thiolase
    • Mitochondrial 3 oxoacyl Coenzyme A thiolase
    • Mitochondrial 3-oxoacyl-CoA thiolase
    • T1
    • THIM_HUMAN
    see all
  • Function
    Abolishes BNIP3-mediated apoptosis and mitochondrial damage.
  • Pathway
    Lipid metabolism; fatty acid metabolism.
  • Sequence similarities
    Belongs to the thiolase family.
  • Cellular localization
    Mitochondrion. Colocalizes with BNIP3 in the mitochondria.
  • Information by UniProt

Images

  • ab161002 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up