Recombinant Human ACAD10 protein (ab132687)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITA EGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAK GLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCL EQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFT LRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL
    • Molecular weight
      53 kDa including tags
    • Amino acids
      49 to 285

Specifications

Our Abpromise guarantee covers the use of ab132687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACAD 10
    • ACAD-10
    • ACAD10
    • ACD10_HUMAN
    • Acyl CoA dehydrogenase family member 10
    • Acyl-CoA dehydrogenase family member 10
    • acyl-Coenzyme A dehydrogenase family member 10
    • MGC5601
    see all
  • Function
    May function as oxidoreductase.
  • Tissue specificity
    Widely expressed with higher expression in liver, kidney, pancreas and spleen.
  • Sequence similarities
    Belongs to the acyl-CoA dehydrogenase family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132687 stained with Coomassie Blue.

References

ab132687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up