Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGGEERLETPSAKKLTDIGIRRIFSPEHDI FRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGG IGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIP QMTAGKCIGAIAMTEPGAGSDLQGIKTNAKKDGSDWILNGSKVFISNGSL SDVVIVVAVTNHEAPSPAHGISLFLVENGMKGFIKGRKLHKMGLKAQDTA ELFFEDIRLPASALLGEENKGFYYIMKELPQERLLIADVAISASEFMFEE TRNYVKQRKAFGKTVAHLQTVQHKLAELKTHICVTRAFVDNCLQLHEAKR LDSATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAKAYVDARVQP IYGGTNEIMKELIAREIVFDK
    • Molecular weight
      47 kDa including tags
    • Amino acids
      31 to 430
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    > 85 % by SDS - PAGE. ab113579 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • ACAD4
    • ACADL
    • ACADL_HUMAN
    • Acyl Coenzyme A dehydrogenase long chain
    • Acyl-CoA dehydrogenase long chain
    • FLJ94052
    • LCAD
    • Long chain acyl CoA dehydrogenase
    • Long-chain specific acyl-CoA dehydrogenase, mitochondrial
    see all
  • Pathway
    Lipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in disease
    Defects in ACADL are a cause of acyl-CoA dehydrogenase very long-chain deficiency (ACADVLD) [MIM:201475]. An inborn error of mitochondrial fatty acid beta-oxidation which leads to impaired long-chain fatty acid beta-oxidation. It is clinically heterogeneous, with three major phenotypes: a severe childhood form characterized by early onset, high mortality and high incidence of cardiomyopathy; a milder childhood form with later onset, characterized by hypoketotic hypoglycemia, low mortality and rare cardiomyopathy; an adult form, with isolated skeletal muscle involvement, rhabdomyolysis and myoglobinuria, usually triggered by exercise or fasting.
  • Sequence similarities
    Belongs to the acyl-CoA dehydrogenase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant Human ACADL protein images

  • 15% SDS-PAGE showing ab113579 (3µg).

References for Recombinant Human ACADL protein (ab113579)

ab113579 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up