Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPV PLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEG NSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTK AEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVE ADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMG AFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAE MAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQI LGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN
    • Molecular weight
      46 kDa including tags
    • Amino acids
      26 to 421
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Sequence for the tag: MGSSHHHHHHSSGLVPRGSHM

Specifications

Our Abpromise guarantee covers the use of ab173059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The purity of ab173059 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituents: 0.24% Tris, 0.58% Sodium chloride, 20% Glycerol

    ab173059 is supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names
    • ACAD 1
    • ACAD1
    • Acadm
    • ACADM_HUMAN
    • Acyl coenzyme A dehydrogenase
    • Acyl coenzyme A dehydrogenase C 4 to C 12 straight chain
    • FLJ18227
    • FLJ93013
    • FLJ99884
    • MCAD
    • MCADH
    • Medium chain acyl CoA dehydrogenase
    • Medium chain fatty acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase mitochondrial
    • Medium-chain specific acyl-CoA dehydrogenase
    • mitochondrial
    see all
  • Function
    This enzyme is specific for acyl chain lengths of 4 to 16.
  • Pathway
    Lipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in disease
    Defects in ACADM are the cause of acyl-CoA dehydrogenase medium-chain deficiency (ACADMD) [MIM:201450]. It is an autosomal recessive disease which causes fasting hypoglycemia, hepatic dysfunction, and encephalopathy, often resulting in death in infancy.
  • Sequence similarities
    Belongs to the acyl-CoA dehydrogenase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References

ab173059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up