Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP11310
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKANRQREPGLGFSFEFTEQQKEFQATARK FAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFD ACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPL MCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLL ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFED VKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYAL ERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYA SIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTS QIQRLIVAREHIDKYKN
    • Molecular weight46 kDa including tags
    • Amino acids26 to 421
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99329 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ACAD 1
    • ACAD1
    • Acadm
    • ACADM_HUMAN
    • Acyl coenzyme A dehydrogenase
    • Acyl coenzyme A dehydrogenase C 4 to C 12 straight chain
    • FLJ18227
    • FLJ93013
    • FLJ99884
    • MCAD
    • MCADH
    • Medium chain acyl CoA dehydrogenase
    • Medium chain fatty acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase mitochondrial
    • Medium-chain specific acyl-CoA dehydrogenase
    • mitochondrial
    see all
  • FunctionThis enzyme is specific for acyl chain lengths of 4 to 16.
  • PathwayLipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in diseaseDefects in ACADM are the cause of acyl-CoA dehydrogenase medium-chain deficiency (ACADMD) [MIM:201450]. It is an autosomal recessive disease which causes fasting hypoglycemia, hepatic dysfunction, and encephalopathy, often resulting in death in infancy.
  • Sequence similaritiesBelongs to the acyl-CoA dehydrogenase family.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt

Recombinant Human ACADM protein images

  • 15% SDS-PAGE analysis of 3µg ab99329.

References for Recombinant Human ACADM protein (ab99329)

ab99329 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"