Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKANRQREPGLGFSFEFTEQQKEFQATARK FAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFD ACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPL MCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLL ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFED VKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYAL ERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYA SIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTS QIQRLIVAREHIDKYKN
    • Molecular weight
      46 kDa including tags
    • Amino acids
      26 to 421
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99329 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ACAD 1
    • ACAD1
    • Acadm
    • ACADM_HUMAN
    • Acyl coenzyme A dehydrogenase
    • Acyl coenzyme A dehydrogenase C 4 to C 12 straight chain
    • FLJ18227
    • FLJ93013
    • FLJ99884
    • MCAD
    • MCADH
    • Medium chain acyl CoA dehydrogenase
    • Medium chain fatty acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase
    • Medium chain specific acyl CoA dehydrogenase mitochondrial
    • Medium-chain specific acyl-CoA dehydrogenase
    • mitochondrial
    see all
  • Function
    This enzyme is specific for acyl chain lengths of 4 to 16.
  • Pathway
    Lipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in disease
    Defects in ACADM are the cause of acyl-CoA dehydrogenase medium-chain deficiency (ACADMD) [MIM:201450]. It is an autosomal recessive disease which causes fasting hypoglycemia, hepatic dysfunction, and encephalopathy, often resulting in death in infancy.
  • Sequence similarities
    Belongs to the acyl-CoA dehydrogenase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99329.

References

ab99329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up