Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMG PYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
    • Amino acids
      73 to 171
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACBD 3
    • ACBD3
    • Acyl CoA binding domain containing protein 3
    • Acyl Coenzyme A binding domain containing 3
    • Acyl-CoA-binding domain-containing protein 3
    • GCP 60
    • GCP60
    • GCP60_HUMAN
    • GOCAP 1
    • GOCAP1
    • Golgi complex associated protein 1
    • Golgi complex associated protein 1 60kDa
    • Golgi complex-associated protein 1
    • Golgi phosphoprotein 1
    • Golgi resident protein GCP60
    • GOLPH 1
    • GOLPH1
    • PAP 7
    • PAP7
    • PBR and PKA associated protein 7
    • PBR associated protein
    • PBR- and PKA-associated protein 7
    • Peripheral benzodiazepine receptor associated protein PAP7
    • Peripheral benzodiazepine receptor-associated protein PAP7
    • Peripherial benzodiazepine receptor associated protein
    • PKA (RIalpha) associated protein
    see all
  • Function
    Involved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi. Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.
  • Tissue specificity
    Ubiquitous, with highest expression in testis and ovary.
  • Sequence similarities
    Contains 1 ACB (acyl-CoA-binding) domain.
    Contains 1 GOLD domain.
  • Domain
    The GOLD domain is essential for giantin binding.
  • Cellular localization
    Golgi apparatus membrane. Mitochondrion. Also mitochondrial (via its interaction with PBR).
  • Information by UniProt

Images

  • ab163866 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up