Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF LGSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRF SQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPK PFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSG RDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIH SQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL DFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQY IGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTV LELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESL RGHPAGMTYAANILPHHPARGTFEDFTC
    • Molecular weight
      84 kDa including tags
    • Amino acids
      1 to 528

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACCN2
    • ACCN2_HUMAN
    • Acid sensing ion channel
    • Acid sensing ion channel 1
    • Acid sensing ion channel 1a protein
    • Acid-sensing ion channel 1
    • AI843610
    • Amiloride sensitive cation channel 2 neuronal
    • Amiloride-sensitive cation channel 2
    • ASIC
    • ASIC1
    • ASIC1A
    • B530003N02Rik
    • BNaC2
    • Brain sodium channel 2
    • Cation channel amiloride sensitive neuronal 2
    • hBNaC2
    • neuronal
    see all
  • Function
    Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Ca(2+), Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Mediates glutamate-independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca(2+) concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear.
  • Tissue specificity
    Expressed in most or all neurons.
  • Sequence similarities
    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily.
  • Post-translational
    modifications
    Phosphorylation by PKA regulates interaction with PRKCABP and subcellular location. Phosphorylation by PKC may regulate the channel.
  • Cellular localization
    Cell membrane. Localizes in synaptosomes at dendritic synapses of neurons. Colocalizes with DLG4.
  • Information by UniProt

Images

  • ab114681 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up