Recombinant Human Acetyl Coenzyme A Carboxylase protein (ab157829)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTP SQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
    • Amino acids
      22 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACAC
    • ACACA
    • ACACA_HUMAN
    • ACACB
    • ACC
    • ACC alpha
    • ACC beta
    • ACC-alpha
    • ACC1
    • ACC2
    • ACCA
    • ACCB
    • Acetyl CoA carboxylase 1
    • Acetyl CoA carboxylase 2
    • Acetyl CoA carboxylase alpha
    • Acetyl CoA carboxylase beta
    • Acetyl Coenzyme A carboxylase alpha
    • Acetyl Coenzyme A carboxylase beta
    • Biotin carboxylase
    • COA1
    • COA2
    • HACC275
    • OTTHUMP00000164069
    • OTTHUMP00000164070
    • OTTHUMP00000164076
    • OTTHUMP00000240532
    see all
  • Function
    Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.
  • Tissue specificity
    Expressed in brain, placental, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver.
  • Pathway
    Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1.
  • Involvement in disease
    Acetyl-CoA carboxylase 1 deficiency
  • Sequence similarities
    Contains 1 ATP-grasp domain.
    Contains 1 biotin carboxylation domain.
    Contains 1 biotinyl-binding domain.
    Contains 1 carboxyltransferase domain.
  • Post-translational
    modifications
    Phosphorylation on Ser-1263 is required for interaction with BRCA1.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab157829 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up