Recombinant Human ACF1 / BAZ1A protein (ab161338)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCF EYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
    • Amino acids
      1457 to 1556
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acf1
    • ACF1, drosophila, homolog of
    • ATP dependent chromatin remodelling protein
    • ATP utilizing chromatin assembly and remodeling factor 1
    • ATP-dependent chromatin-remodeling protein
    • ATP-utilizing chromatin assembly and remodeling factor 1
    • B930060C03
    • Baz1a
    • BAZ1A_HUMAN
    • BC065123
    • Bromodomain adjacent to zinc finger domain 1A
    • Bromodomain adjacent to zinc finger domain protein 1A
    • cbp146
    • CHRAC subunit ACF1
    • DKFZp586E0518
    • FLJ14383
    • Gtl5
    • hACF1
    • hWALp1
    • WALp1
    • WCRF180
    • Williams syndrome transcription factor related chromatin remodeling factor 180
    • Williams syndrome transcription factor-related chromatin-remodeling factor 180
    see all
  • Function
    Component of the ACF complex, an ATP-dependent chromatin remodeling complex, that regulates spacing of nucleosomes using ATP to generate evenly spaced nucleosomes along the chromatin. The ATPase activity of the complex is regulated by the length of flanking DNA. Also involved in facilitating the DNA replication process. BAZ1A is the accessory, non-catalytic subunit of the complex which can enhance and direct the process provided by the ATPase subunit, SMARCA5, probably through targeting pericentromeric heterochromatin in late S phase. Moves end-positioned nucleosomes to a predominantly central position. May have a role in nuclear receptor-mediated transcription repression.
    Component of the histone-fold protein complex CHRAC complex which faciliates nucleosome sliding by the ACF complex and enhances ACF-mediated chromatin assembly. The C-terminal regions of both CHRAC1 and POLE1 are required for these functions.
  • Tissue specificity
    Highly expressed in testis and at low or undetectable levels in other tissues analyzed.
  • Sequence similarities
    Belongs to the WAL family.
    Contains 1 bromo domain.
    Contains 1 DDT domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 WAC domain.
  • Cellular localization
    Nucleus. May target the CHRAC complex to heterochromatin.
  • Information by UniProt

Images

  • ab161338 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up