Recombinant Human ACF1 / BAZ1A protein (ab195158)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEPSPVTLGRRSSGRQGGVH ELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKV NKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKL GLHVTPSNVDQV
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1415 to 1545
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      single bromodomain

Associated products

Specifications

Our Abpromise guarantee covers the use of ab195158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names
    • Acf1
    • ACF1, drosophila, homolog of
    • ATP dependent chromatin remodelling protein
    • ATP utilizing chromatin assembly and remodeling factor 1
    • ATP-dependent chromatin-remodeling protein
    • ATP-utilizing chromatin assembly and remodeling factor 1
    • B930060C03
    • Baz1a
    • BAZ1A_HUMAN
    • BC065123
    • Bromodomain adjacent to zinc finger domain 1A
    • Bromodomain adjacent to zinc finger domain protein 1A
    • cbp146
    • CHRAC subunit ACF1
    • DKFZp586E0518
    • FLJ14383
    • Gtl5
    • hACF1
    • hWALp1
    • WALp1
    • WCRF180
    • Williams syndrome transcription factor related chromatin remodeling factor 180
    • Williams syndrome transcription factor-related chromatin-remodeling factor 180
    see all
  • Function
    Component of the ACF complex, an ATP-dependent chromatin remodeling complex, that regulates spacing of nucleosomes using ATP to generate evenly spaced nucleosomes along the chromatin. The ATPase activity of the complex is regulated by the length of flanking DNA. Also involved in facilitating the DNA replication process. BAZ1A is the accessory, non-catalytic subunit of the complex which can enhance and direct the process provided by the ATPase subunit, SMARCA5, probably through targeting pericentromeric heterochromatin in late S phase. Moves end-positioned nucleosomes to a predominantly central position. May have a role in nuclear receptor-mediated transcription repression.
    Component of the histone-fold protein complex CHRAC complex which faciliates nucleosome sliding by the ACF complex and enhances ACF-mediated chromatin assembly. The C-terminal regions of both CHRAC1 and POLE1 are required for these functions.
  • Tissue specificity
    Highly expressed in testis and at low or undetectable levels in other tissues analyzed.
  • Sequence similarities
    Belongs to the WAL family.
    Contains 1 bromo domain.
    Contains 1 DDT domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 WAC domain.
  • Cellular localization
    Nucleus. May target the CHRAC complex to heterochromatin.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE using of 2.7 µg ab195158. Coomassie staining.

References

ab195158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up