Overview

  • Product name
    Recombinant Human Acf7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVR VGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
    • Amino acids
      1 to 95
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 620 kDa actin-binding protein
    • ABP620
    • Actin cross-linking family protein 7
    • MACF1
    • Macrophin-1
    • Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
    • Trabeculin-alpha
    see all
  • Relevance
    MACF1 (microtubule actin cross-linking factor 1) is a multidomain protein that can associate with microfilaments and microtubules. MACF1 is a F-actin-binding protein which may play a role in cross-linking actin to other cytoskeletal proteins and may also binds to microtubules. MACF1 may also play a role in the Wnt signaling pathway.
  • Cellular localization
    cytoplasmic

Images

  • ab161666 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up