Recombinant Human Acidic Calponin protein (ab116868)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15417
    • SpeciesHuman
    • SequenceMTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQL GLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKP HDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTR RFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFD QTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTN KVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY QAEYPDEYHGEYQDDYPRDYQYSDQGIDY
    • Molecular weight62 kDa including tags
    • Amino acids1 to 329

Specifications

Our Abpromise guarantee covers the use of ab116868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Acidic calponin 3
    • acidic isoform
    • Calponin
    • Calponin 3
    • Calponin 3 acidic
    • Calponin acidic
    • Calponin acidic isoform
    • Calponin-3
    • Calponin3
    • CNN 3
    • Cnn3
    • CNN3_HUMAN
    • dJ639P13.2.2
    • OTTHUMP00000012470
    • OTTHUMP00000012471
    see all
  • FunctionThin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
  • Tissue specificityExpressed in both non-smooth muscle tissues as well as smooth muscle tissues.
  • Sequence similaritiesBelongs to the calponin family.
    Contains 3 calponin-like repeats.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt

Recombinant Human Acidic Calponin protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116868 at approximately 62.26 kDa.

References for Recombinant Human Acidic Calponin protein (ab116868)

ab116868 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us and for your interest in our products.

I am sorry to confirm that as far as we are aware, ab116868Acidic Calponin proteinhas never been tested in these type of functional studies. All tested and guaranteed applica...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"