Recombinant Human Acidic Calponin protein (ab116869)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEP VIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
    • Molecular weight
      37 kDa including tags
    • Amino acids
      230 to 329

Specifications

Our Abpromise guarantee covers the use of ab116869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acidic calponin 3
    • acidic isoform
    • Calponin
    • Calponin 3
    • Calponin 3 acidic
    • Calponin acidic
    • Calponin acidic isoform
    • Calponin-3
    • Calponin3
    • CNN 3
    • Cnn3
    • CNN3_HUMAN
    • dJ639P13.2.2
    • OTTHUMP00000012470
    • OTTHUMP00000012471
    see all
  • Function
    Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
  • Tissue specificity
    Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
  • Sequence similarities
    Belongs to the calponin family.
    Contains 3 calponin-like repeats.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116869 at approximately 36.63 kDa.

References

ab116869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up