Recombinant Human Aconitase 1 protein (ab103501)

Overview

  • Product nameRecombinant Human Aconitase 1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP21399
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMSNPFAHLAEPLDPVQPGKKFFNLNKL EDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVP FKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHS IQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGII HQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAE AVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKF VEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDE EKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQ DKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNTEFTLAHG SVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGV VTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLV AVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGV NAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALA TPSDKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTT DHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANI RLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAG SSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADAL GLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNG GILNYMIRKMAK
    • Molecular weight101 kDa including tags
    • Amino acids1 to 889
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab103501 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • ACO 1
    • ACO1
    • ACOC_HUMAN
    • Aconitase
    • Aconitase 1 soluble
    • Aconitase1
    • Aconitate hydratase
    • ACONS
    • Citrate hydro lyase
    • Citrate hydro-lyase
    • Cytoplasmic aconitate hydratase
    • Ferritin repressor protein
    • IRE BP 1
    • IRE-BP 1
    • IREB 1
    • IREB1
    • IREBP
    • IREBP1
    • Iron regulatory protein 1
    • Iron responsive element binding protein 1
    • Iron-responsive element-binding protein 1
    • IRP 1
    • IRP1
    • OTTHUMP00000045233
    see all
  • FunctionIron sensor. Binds a 4Fe-4S cluster and functions as aconitase when cellular iron levels are high. Functions as mRNA binding protein that regulates uptake, sequestration and utilization of iron when cellular iron levels are low. Binds to iron-responsive elements (IRES) in target mRNA species when iron levels are low. Binding of a 4Fe-4S cluster precludes RNA binding.
    Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.
  • Sequence similaritiesBelongs to the aconitase/IPM isomerase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Aconitase 1 protein images

  • 15% SDS-PAGE analysis of 3µg ab103501.

References for Recombinant Human Aconitase 1 protein (ab103501)

ab103501 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"