Recombinant Human Aconitase 2 protein (ab114378)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEK NINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQD ATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEV YNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGG LGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILK VAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN HRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHIN GPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVA KQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDLGGIVLMAPYSL LVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVR KRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMA MLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLAT AGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICI GVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGIL
    • Molecular weight
      111 kDa including tags
    • Amino acids
      1 to 780

Specifications

Our Abpromise guarantee covers the use of ab114378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ACO 2
    • ACO2
    • ACON_HUMAN
    • Aconitase
    • aconitase 2
    • Aconitase 2 mitochondrial
    • Aconitase2
    • Aconitate hydratase
    • Aconitate hydratase mitochondrial
    • ACONM
    • Citrate hydro lyase
    • Citrate hydro-lyase
    • ICRD
    • mitochondrial
    see all
  • Function
    Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.
  • Pathway
    Carbohydrate metabolism; tricarboxylic acid cycle; isocitrate from oxaloacetate: step 2/2.
  • Sequence similarities
    Belongs to the aconitase/IPM isomerase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human Aconitase 2 protein images

  • ab114378 on 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Aconitase 2 protein (ab114378)

ab114378 has not yet been referenced specifically in any publications.

Product Wall

I have processed the free of charge replacement for both of these proteins. They are both out of stock and i have placed the estimated delivery date for them below (we will ship each one as soon as it comes into stock):

ab82944 - FOCR #Order ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up