Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALR RKVESIIHSYPEFSCKDNYFMTQNERYKAAMRRAFHIRLIARRLGWLEDG RELGYAYRALSGDVALNIHRVFVRALRSLGSEEQIAKWDPLCKNIQIIAT YAQTELGHGTYLQGLETEATYDAATQEFVIHSPTLTATKWWPGDLGRSAT HALVQAQLICSGARRGMHAFIVPIRSLQDHTPLPGIIIGDIGPKMDFDQT DNGFLQLNHVRVPRENMLSRFAQVLPDGTYVKLGTAQSNYLPMVVVRVEL LSGEILPILQKACVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQ LAISYAFHFLAVSLLEFFQHSYTAILNQDFSFLPELHALSTGMKAMMSEF CTQGAEMCRRACGGHGYSKLSGLPSLVTKLSASCTYEGENTVLYLQVARF LVKSYLQTQMSPGSTPQRSLSPSVAYLTAPDLARCPAQRAADFLCPELYT TAWAHVAVRLIKDSVQHLQTLTQSGADQHEAWNQTTVIHLQAAKVHCYYV TVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGA QVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLF QWAQKSPTNTQENPAYEEYIRPLLQSWRSKL
    • Amino acids
      1 to 681
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase
    • 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase
    • 3 alpha 7 alpha 12 alpha trihydroxy 5 beta cholestanoyl CoA oxidase
    • 3 alpha 7 alpha12 alpha trihydroxy 5 beta cholestanoyl CoA 24 hydroxylase
    • 3-alpha
    • 7-alpha
    • ACOX 2
    • ACOX2
    • ACOX2_HUMAN
    • Acyl CoA oxidase 2
    • Acyl Coenzyme A oxidase 2
    • Acyl Coenzyme A oxidase 2 branched chain
    • Acyl coenzyme A oxidase 2 peroxisomal
    • BCOX
    • BRCACOX
    • BRCOX
    • Peroxisomal acyl-coenzyme A oxidase 2
    • Peroxisomal branched chain acyl CoA oxidase
    • THCA CoA oxidase
    • THCA-CoA oxidase
    • THCCox
    • Trihydroxycoprostanoyl CoA oxidase
    • Trihydroxycoprostanoyl-CoA oxidase
    see all
  • Function
    Oxidizes the CoA esters of the bile acid intermediates di- and tri-hydroxycholestanoic acids.
  • Tissue specificity
    Present in all tissues tested: heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Most abundant in heart, liver and kidney.
  • Sequence similarities
    Belongs to the acyl-CoA oxidase family.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • ab159985 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up