Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKT IFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP LKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRM EIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNM GKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVGDIGKK LGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGAS LGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYP MQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREI HALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTY EGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKF EVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKC QVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSL SRHAALLYRAERRCSCPGRRDRSS
    • Amino acids
      1 to 624
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACOX3
    • Acyl-CoA oxidase 3, pristanoyl
    • Acyl-CoA oxidase, pristanoyl, peroxisomal
    • Acyl-Coenzyme A oxidase 3, pristanoyl
    • Branched-chain acyl-CoA oxidase
    • BRCACox
    • BRCOX
    • EST-s59
    • PCOX
    • Peroxisomal acyl-coenzyme A oxidase 3
    • Pristanoyl-CoA oxidase
    see all
  • Relevance
    ACOX3 also know as pristanoyl -CoA oxidase or Acyl-Coenzyme A oxidase 3 is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.
  • Cellular localization
    Peroxisome

Images

  • ab159987 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up