Overview

  • Product name
    Recombinant Human ACRBP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRKPAAGFLPSLLKVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALL TPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWF ESFCQFTHYRCSNHVYYAKRVLCSQPVSILSPNTLKEIEASAEVSPTTMT SPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQG VEHRQEPTQEHKQEEGQKQEEQEEEQEEEGKQEEGQGTKEGREAVSQLQT DSEPKFHSESLSSNPSSFAPRVREVESTPMIMENIQELIRSAQEIDEMNE IYDENSYWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYME EEILGFGKSVCDSLGRRHMSTCALCDFCSLKLEQCHSEASLQRQQCDTSH KTPFVSPLLASQSLSIGNQVGSPESGRFYGLDLYGGLHMDFWCARLATKG CEDVRVSGWLQTEFLSFQDGDFPTKICDTDYIQYPNYCSFKSQQCLMRNR NRKVSRMRCLQNETYSALSPGKSEDVVLRWSQEFSTLTLGQFG
    • Amino acids
      1 to 543
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACRBP
    • ACRBP_HUMAN
    • acrosin binding protein
    • Acrosin binding protein precursor
    • Acrosin-binding protein
    • Cancer/testis antigen 23
    • Cancer/testis antigen OY TES 1
    • Cancer/testis antigen OY-TES-1
    • CT23
    • FLJ51160
    • OY TES 1
    • Proacrosin binding protein sp32
    • Proacrosin-binding protein sp32
    • SP32
    see all
  • Function
    May be involved in packaging and condensation of the acrosin zymogen in the acrosomal matrix via its association with proacrosin.
  • Tissue specificity
    Expression restricted to testis in normal tissue. Expressed in a wide spectrum of cancers, including bladder, breast, liver, lung and colon cancers.
  • Post-translational
    modifications
    The N-terminus is blocked.
    Phosphorylated on Tyr residues in capacitated sperm.
  • Cellular localization
    Secreted. Cytoplasmic vesicle, secretory vesicle, acrosome. Colocalizes with proacrosin in the acrosome of sperm.
  • Information by UniProt

Images

  • ab164607 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up