Recombinant Human ACSBG1 protein (ab132702)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQ PLSKESLNHALELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQ LPYTVHRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYLLARRAAKGFL KLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIA YDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTME EFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCF AEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKM LLWAMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFY GAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLV PGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGD AGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEII EKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTM KLKRLTVLEKYKGIIDSFYQEQKM
    • Molecular weight
      108 kDa including tags
    • Amino acids
      1 to 724

Specifications

Our Abpromise guarantee covers the use of ab132702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACBG1_HUMAN
    • ACSBG 1
    • ACSBG1
    • Acyl CoA synthetase bubblegum family member 1
    • Acyl-CoA synthetase bubblegum family member 1
    • BG
    • BG1
    • BGM
    • Bubblegum
    • FLJ30320
    • GR LACS
    • GRLACS
    • hBG1
    • hsBG
    • hsBGM
    • KIAA0631
    • Lipidosin
    • Lipodisin
    • Long chain fatty acid CoA ligase ACSBG1
    • Long-chain-fatty-acid--CoA ligase ACSBG1
    • LPD
    • MGC14352
    • Ortholog of rodent gonadotropin regulated long chain acyl CoA synthetase
    • Very long chain acyl CoA synthetase
    see all
  • Function
    Mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. Can activate diverse saturated, monosaturated and polyunsaturated fatty acids.
  • Tissue specificity
    Expressed primarily in brain. Expressed at lower level in testis and adrenal gland. Present in all regions of brain except pituitary.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family. Bubblegum subfamily.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle. Microsome. Endoplasmic reticulum.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132702 stained with Coomassie Blue.

References

ab132702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up