Recombinant Human ACSBG1 protein (ab132702)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQ PLSKESLNHALELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQ LPYTVHRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYLLARRAAKGFL KLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIA YDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTME EFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCF AEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKM LLWAMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFY GAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLV PGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGD AGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEII EKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTM KLKRLTVLEKYKGIIDSFYQEQKM
    • Molecular weight
      108 kDa including tags
    • Amino acids
      1 to 724

Specifications

Our Abpromise guarantee covers the use of ab132702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACBG1_HUMAN
    • ACSBG 1
    • ACSBG1
    • Acyl CoA synthetase bubblegum family member 1
    • Acyl-CoA synthetase bubblegum family member 1
    • BG
    • BG1
    • BGM
    • Bubblegum
    • FLJ30320
    • GR LACS
    • GRLACS
    • hBG1
    • hsBG
    • hsBGM
    • KIAA0631
    • Lipidosin
    • Lipodisin
    • Long chain fatty acid CoA ligase ACSBG1
    • Long-chain-fatty-acid--CoA ligase ACSBG1
    • LPD
    • MGC14352
    • Ortholog of rodent gonadotropin regulated long chain acyl CoA synthetase
    • Very long chain acyl CoA synthetase
    see all
  • Function
    Mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. Can activate diverse saturated, monosaturated and polyunsaturated fatty acids.
  • Tissue specificity
    Expressed primarily in brain. Expressed at lower level in testis and adrenal gland. Present in all regions of brain except pituitary.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family. Bubblegum subfamily.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle. Microsome. Endoplasmic reticulum.
  • Information by UniProt

Recombinant Human ACSBG1 protein images

  • 12.5% SDS-PAGE analysis of ab132702 stained with Coomassie Blue.

References for Recombinant Human ACSBG1 protein (ab132702)

ab132702 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up