Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRM VSTPIGGLSYVQGCTKKHLNSKTVVQCLETTAQRVPEREALVVLHEDVRL TFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLMQLATAQAGII LVSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENA QPGALKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQ FLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERLKLHEKTPEQ LRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERG TFLYGTPTMFVDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKIN MKDLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAG TLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQ GFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDRMGE EICACIRLKDGEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKI QKFKLREQMERHLNL
    • Amino acids
      1 to 615
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACSF 2
    • Acsf2
    • ACSF2_HUMAN
    • ACSMW
    • Acyl CoA synthetase family member 2
    • Acyl CoA synthetase family member 2 mitochondrial
    • Acyl-CoA synthetase family member 2
    • AVYV493
    • FLJ20920
    • mitochondrial
    • PPARG binding long chain fatty acid acyl Co A ligase like
    • Putative uncharacterized protein FLJ20920
    see all
  • Function
    Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab164226 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up