Overview

  • Product nameRecombinant Human ACSL1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP33121
    • SpeciesHuman
    • SequencePKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQ RGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
    • Molecular weight36 kDa including tags
    • Amino acids48 to 145

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACS 1
    • ACS1
    • ACSL 1
    • ACSL1
    • ACSL1_HUMAN
    • Acyl CoA synthetase 1
    • Acyl CoA synthetase long chain family member 1
    • Acyl-CoA synthetase 1
    • FACL 1
    • FACL 2
    • FACL1
    • FACL2
    • Fatty acid Coenzyme A ligase long chain 1
    • Fatty acid Coenzyme A ligase long chain 2
    • LACS
    • LACS 1
    • LACS 2
    • LACS1
    • LACS2
    • Lignoceroyl CoA synthase
    • Long chain acyl CoA synthetase 1
    • Long chain acyl CoA synthetase 2
    • Long chain fatty acid CoA ligase 1
    • Long chain fatty acid CoA ligase 2
    • Long chain fatty acid coenzyme A ligase 1
    • Long-chain acyl-CoA synthetase 1
    • Long-chain acyl-CoA synthetase 2
    • Long-chain fatty acid-CoA ligase 2
    • Long-chain-fatty-acid--CoA ligase 1
    • Palmitoyl CoA ligase 1
    • Palmitoyl CoA ligase 2
    • Palmitoyl-CoA ligase 1
    • Palmitoyl-CoA ligase 2
    • Paltimoyl CoA ligase 1
    see all
  • FunctionActivation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate.
  • Tissue specificityHighly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas.
  • Sequence similaritiesBelongs to the ATP-dependent AMP-binding enzyme family.
  • Developmental stageExpressed during the early stages of erythroid development while expression is very low in reticulocytes and young erythrocytes.
  • Cellular localizationMitochondrion outer membrane. Peroxisome membrane. Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human ACSL1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116839 at approximately 36.41 kDa.

References for Recombinant Human ACSL1 protein (ab116839)

ab116839 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"