Overview

  • Product name
    Recombinant Human ACSL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQ RGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
    • Molecular weight
      36 kDa including tags
    • Amino acids
      48 to 145

Specifications

Our Abpromise guarantee covers the use of ab116839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACS 1
    • ACS1
    • ACSL 1
    • ACSL1
    • ACSL1_HUMAN
    • Acyl CoA synthetase 1
    • Acyl CoA synthetase long chain family member 1
    • Acyl-CoA synthetase 1
    • FACL 1
    • FACL 2
    • FACL1
    • FACL2
    • Fatty acid Coenzyme A ligase long chain 1
    • Fatty acid Coenzyme A ligase long chain 2
    • LACS
    • LACS 1
    • LACS 2
    • LACS1
    • LACS2
    • Lignoceroyl CoA synthase
    • Long chain acyl CoA synthetase 1
    • Long chain acyl CoA synthetase 2
    • Long chain fatty acid CoA ligase 1
    • Long chain fatty acid CoA ligase 2
    • Long chain fatty acid coenzyme A ligase 1
    • Long-chain acyl-CoA synthetase 1
    • Long-chain acyl-CoA synthetase 2
    • Long-chain fatty acid-CoA ligase 2
    • Long-chain-fatty-acid--CoA ligase 1
    • Palmitoyl CoA ligase 1
    • Palmitoyl CoA ligase 2
    • Palmitoyl-CoA ligase 1
    • Palmitoyl-CoA ligase 2
    • Paltimoyl CoA ligase 1
    see all
  • Function
    Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate.
  • Tissue specificity
    Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Developmental stage
    Expressed during the early stages of erythroid development while expression is very low in reticulocytes and young erythrocytes.
  • Cellular localization
    Mitochondrion outer membrane. Peroxisome membrane. Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116839 at approximately 36.41 kDa.

References

ab116839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up