Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRG LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS
    • Amino acids
      91 to 186
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACS2
    • ACS5
    • Acyl CoA synthetase 5
    • Acyl CoA synthetase long chain family member 5
    • EC 6.2.1.3
    • FACL5
    • FACL5 for fatty acid coenzyme A ligase 5
    • Fatty acid CoA ligase, long chain 5
    • Fatty acid coenzyme A ligase 5
    • Fatty acid Coenzyme A ligase long chain 5
    • LACS 5
    • Long chain acyl CoA synthetase 5
    • Long chain fatty acid CoA ligase 5
    • Long chain fatty acid coenzyme A ligase 5
    see all
  • Relevance
    ACSL5 is an isozyme of the long chain fatty acid coenzyme A ligase family. All isozymes of this family convert free long chain fatty acids into fatty acyl CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. ACSL5 is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid induced glioma cell growth. Three transcript variants encoding two different isoforms have been found.
  • Cellular localization
    Mitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane. Endoplasmic reticulum membrane.

Images

  • ab162641 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up