Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPE EHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTT GIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYS FVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVIT IGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASL STFQQMWISKPEYDEAGPSIVHRKCF
    • Amino acids
      1 to 376
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACT
    • ACTA3
    • ACTE
    • ACTG2
    • ACTH_HUMAN
    • Actin
    • Actin gamma 2 smooth muscle enteric
    • Actin gamma enteric smooth muscle
    • Actin like protein
    • ACTL3
    • ACTSG
    • Alpha actin 3
    • Alpha-actin-3
    • Gamma 2 actin
    • Gamma-2-actin
    • gamma-enteric smooth muscle
    • Smooth muscle gamma actin
    • Smooth muscle gamma-actin
    see all
  • Function
    Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
  • Sequence similarities
    Belongs to the actin family.
  • Post-translational
    modifications
    Oxidation of Met-45 and Met-48 by MICALs (MICAL1, MICAL2 or MICAL3) to form methionine sulfoxide promotes actin filament depolymerization. MICAL1 and MICAL2 produce the (R)-S-oxide form. The (R)-S-oxide form is reverted by MSRB1 and MSRB2, which promote actin repolymerization.
    Monomethylation at Lys-85 (K84me1) regulates actin-myosin interaction and actomyosin-dependent processes. Demethylation by ALKBH4 is required for maintaining actomyosin dynamics supporting normal cleavage furrow ingression during cytokinesis and cell migration.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab157842 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up