Recombinant Human Activin A Receptor Type IB protein (ab132045)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDG ACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDY CNRIDLRVPSGHLKEPEHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVIN YHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQ RTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEI YQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCA IADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKC ADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQ KLRPNIPNWWQSYEALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQ EDVKI
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 505
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activin A receptor type 1B
    • Activin A receptor type II like kinase 4
    • Activin A type 1B receptor
    • Activin A type IB receptor
    • Activin receptor like kinase 4
    • Activin receptor type 1B
    • Activin receptor type IB
    • Activin receptor type-1B
    • Activin receptor-like kinase 4
    • ACTR IB
    • ACTR-IB
    • ACTRIB
    • ACV1B_HUMAN
    • ACVR 1B
    • Acvr1b
    • ACVRLK 4
    • ACVRLK4
    • ALK 4
    • ALK-4
    • ALK4
    • Serine(threonine) protein kinase receptor R2
    • Serine/threonine-protein kinase receptor R2
    • SKR 2
    • SKR2
    see all
  • Function
    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Phosphorylates TDP2.
  • Tissue specificity
    Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132045 stained with Coomassie Blue.

References

ab132045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up