Recombinant Human Activin A Receptor Type IB protein (ab132045)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDG ACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDY CNRIDLRVPSGHLKEPEHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVIN YHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQ RTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEI YQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCA IADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKC ADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQ KLRPNIPNWWQSYEALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQ EDVKI
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 505
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activin A receptor type 1B
    • Activin A receptor type II like kinase 4
    • Activin A type 1B receptor
    • Activin A type IB receptor
    • Activin receptor like kinase 4
    • Activin receptor type 1B
    • Activin receptor type IB
    • Activin receptor type-1B
    • Activin receptor-like kinase 4
    • ACTR IB
    • ACTR-IB
    • ACTRIB
    • ACV1B_HUMAN
    • ACVR 1B
    • Acvr1b
    • ACVRLK 4
    • ACVRLK4
    • ALK 4
    • ALK-4
    • ALK4
    • Serine(threonine) protein kinase receptor R2
    • Serine/threonine-protein kinase receptor R2
    • SKR 2
    • SKR2
    see all
  • Function
    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Phosphorylates TDP2.
  • Tissue specificity
    Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Activin A Receptor Type IB protein images

  • 12.5% SDS-PAGE analysis of ab132045 stained with Coomassie Blue.

References for Recombinant Human Activin A Receptor Type IB protein (ab132045)

ab132045 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up