Recombinant Human Activin Receptor Type IIA protein (ab114449)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEI VKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVT QPTSNPVTPK
    • Molecular weight
      38 kDa including tags
    • Amino acids
      24 to 133

Specifications

Our Abpromise guarantee covers the use of ab114449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activin A receptor type IIA
    • Activin receptor type 2A
    • Activin receptor type IIA
    • Activin receptor type-2A
    • ACTR 2
    • ACTR IIA
    • ACTR-IIA
    • ACTR2
    • ACTRII
    • ACTRIIA
    • Acvr 2
    • Acvr 2A
    • Acvr2
    • ACVR2A
    • AVR2A_HUMAN
    • OTTHUMP00000197918
    see all
  • Function
    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114449 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up