Recombinant Human Activin Receptor Type IIA protein (ab152023)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISG SIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPE MEVTQPTSNPVTPKPVDHHHHHH
    • Molecular weight
      14 kDa including tags
    • Amino acids
      20 to 134
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • Activin A receptor type IIA
    • Activin receptor type 2A
    • Activin receptor type IIA
    • Activin receptor type-2A
    • ACTR 2
    • ACTR IIA
    • ACTR-IIA
    • ACTR2
    • ACTRII
    • ACTRIIA
    • Acvr 2
    • Acvr 2A
    • Acvr2
    • ACVR2A
    • AVR2A_HUMAN
    • OTTHUMP00000197918
    see all
  • Function
    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab152023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up