Recombinant Human Activin Receptor Type IIB protein (ab114487)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMNDFVAVKIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEV ELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCR GEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQV GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDE YMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEE CWDHDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLPPKE SSI
    • Molecular weight59 kDa including tags
    • Amino acids1 to 303

Specifications

Our Abpromise guarantee covers the use of ab114487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activin A receptor type IIB
    • Activin receptor type 2B
    • Activin receptor type IIB
    • Activin receptor type-2B
    • ActR IIB
    • ACTR-IIB
    • ActRIIB
    • ACVR 2B
    • ACVR2B
    • AVR2B_HUMAN
    • HTX4
    • MGC116908
    see all
  • FunctionOn ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A.
  • Involvement in diseaseDefects in ACVR2B are the cause of visceral heterotaxy autosomal type 4 (HTX4) [MIM:613751]. A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects. Clinical features of visceral heterotaxy type 4 include dextrocardia, right aortic arch and a right-sided spleen, anomalies of the inferior and the superior vena cava, atrial ventricular canal defect with dextro-transposed great arteries, pulmonary stenosis, polysplenia and midline liver.
  • Sequence similaritiesBelongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 protein kinase domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Activin Receptor Type IIB protein images

  • 12.5% SDS-PAGE showing ab114487 at approximately 59.40kDa stained with Coomassie Blue.

References for Recombinant Human Activin Receptor Type IIB protein (ab114487)

ab114487 has not yet been referenced specifically in any publications.

Product Wall

Thank you for calling Abcam earlier today.

If my calculations are correct, then you would need 1.3ul of ab114487 to get 200ng.

If there is anything else I can help you with, please let me know.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"