Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSE PQ EPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTT VGKPYM ETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTV QDIWEYLFRQ EMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTP AMHIAYQSRLSMYS YGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRL DYAGSDLTAYLLGLLNSA GNEFTQDQMGIVEDIKKKCCFVALDPIEEK KVPLSEHTIRYVLPDGKEIQLC QERFLCSEMFFKPSLIKSMQLGLHTQ TVSCLNKCDIALKRDLMGNILLCGGS TMLSGFPNRLQKELSSMCPNDT PQVNVLPERDSAVWTGGSILASLQGFQPLW VHRFEYEEHGPFFLYRRC F

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Actin like 7 alpha
    • Actin like protein 7A
    • RP11-3J11.3
  • RelevanceACTL7A is a member of a family of actin related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7A), and related gene, ACTL7B, are intronless, and are located approximately 4 kb apart in a head to head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7A gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. The ACTL7A gene is expressed in a wide variety of adult tissues, however, its exact function is not known.
  • Cellular localizationCytoplasm

References for Recombinant Human ACTL7A protein (ab88853)

ab88853 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"