Recombinant Human ACTR1A protein (ab132058)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESYDVSANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAG ALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQ TFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYAT GRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRK EGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIE IGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASL DTFKKMWVSKKEYEEDGARSIHRKTF
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 376

Specifications

Our Abpromise guarantee covers the use of ab132058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Actin related protein 1
    • Actin RPV
    • Actin-RPV
    • ACTR 1A
    • Actr1a
    • ACTZ_HUMAN
    • Alpha centractin
    • Alpha-centractin
    • ARP 1
    • ARP1
    • ARP1 actin related protein 1 homolog A
    • ARP1 actin related protein 1 homolog A centractin alpha
    • ARP1 yeast homolog A
    • Centractin
    • Centractin alpha
    • Centrosome associated actin homolog
    • Centrosome-associated actin homolog
    • CTRN 1
    • CTRN1
    • FLJ52695
    • FLJ52800
    • FLJ55002
    see all
  • Function
    Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome.
  • Sequence similarities
    Belongs to the actin family. ARP1 subfamily.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue, showing ab132058 at approximately 67.10 kDa.

References

ab132058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up