Overview

  • Product name
    Recombinant Human ACTR8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNHKVMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVE DGVSHRNTRIFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPM ALFYPATFGIVGQKMTTLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATA DRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDGLMAGNDSEEA LTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGG GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGA VLACLDTTQELWIYQREWQ RFGVRMLRERAAFVW
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 329
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab172851 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% PBS, 0.02% DTT

General Info

  • Alternative names
    • Actin-related protein 8
    • Actr8
    • ARP8_HUMAN
    • hArp8
    • INO80 complex subunit N
    see all
  • Function
    Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize.
    Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA reoplication and probably DNA repair. Required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage. Strongly prefer nucleosomes and H3-H4 tetramers over H2A-H2B dimers, suggesting it may act as a nucleosome recognition module within the complex.
  • Sequence similarities
    Belongs to the actin family. ARP8 subfamily.
  • Cellular localization
    Nucleus. Chromosome. Specifically localizes to mitotic chromosomes.
  • Information by UniProt

References

ab172851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up