Overview

  • Product name
    Recombinant Human ACY3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMCSLPVPREPLRRVAVTGGTHGNEMSG VYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSF LNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLI AKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGL ELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVG VVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGEST VYPVFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 319
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab109954 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AA3
    • ACY-3
    • acy3
    • ACY3_HUMAN
    • Acylase III
    • Aminoacylase 3
    • Aminoacylase III
    • Aminoacylase-3
    • ASPA2
    • Aspartoacylase (aminoacylase) 3
    • Aspartoacylase 2
    • Aspartoacylase-2
    • AW107362
    • EC 3.5.1.-
    • EC 3.5.1.15
    • HCBP1
    • Hepatitis C virus core binding protein 1
    • Hepatitis C virus core-binding protein 1
    see all
  • Function
    Plays an important role in deacetylating mercapturic acids in kidney proximal tubules.
  • Sequence similarities
    Belongs to the AspA/AstE family. Aspartoacylase subfamily.
  • Cellular localization
    Apical cell membrane. Cytoplasm. Predominantly localized in the apical membrane of cells in the S1 segment. In the proximal straight tubules (S2 and S3 segments) is expressed diffusely throughout the cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab109954 (3µg)

References

ab109954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up