Recombinant Human Acyl-coenzyme A Thioesterase 8 protein (ab160760)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETL IDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMF WVRARGYI
    • Amino acids
      108 to 215
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACTEIII
    • Acot8
    • ACOT8_HUMAN
    • Acyl CoA thioesterase 8
    • Acyl-CoA thioesterase 8
    • Acyl-coenzyme A thioesterase 8
    • Choloyl coenzyme A thioesterase
    • Choloyl-coenzyme A thioesterase
    • hACTE III
    • hACTE-III
    • hACTEIII
    • HIV Nef associated acyl CoA thioesterase
    • HIV-Nef-associated acyl-CoA thioesterase
    • HNAACTE
    • hTE
    • Long chain fatty acyl CoA hydrolase
    • Palmitoyl CoA hydrolase
    • Peroxisomal acyl CoA thioesterase 1
    • Peroxisomal acyl coenzyme A thioester hydrolase 1
    • Peroxisomal acyl-coenzyme A thioester hydrolase 1
    • Peroxisomal long chain acyl CoA thioesterase 1
    • Peroxisomal long-chain acyl-CoA thioesterase 1
    • PTE 1
    • PTE 2
    • PTE-1
    • PTE-2
    • PTE1
    • PTE2
    • Thioesterase II
    see all
  • Function
    Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May mediate Nef-induced down-regulation of CD4. Major thioesterase in peroxisomes. Competes with BAAT (Bile acid CoA: amino acid N-acyltransferase) for bile acid-CoA substrate (such as chenodeoxycholoyl-CoA). Shows a preference for medium-length fatty acyl-CoAs (By similarity). May be involved in the metabolic regulation of peroxisome proliferation.
  • Tissue specificity
    Detected in a T-cell line (at protein level). Ubiquitous.
  • Sequence similarities
    Belongs to the C/M/P thioester hydrolase family.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • ab160760 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up