Recombinant Human Acylglycerol Kinase protein (ab163203)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFG NQLIPPNAQVKKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTIVKT DYEGQAKKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIG FIPLGETSSLSHTLFAESGNKVQHITDATLAIVKGETVPLDVLQIKGEKE QPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQA SISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSP EVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGS RKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLL PRKLQFFCDPRKREQMLTSPTQ
    • Amino acids
      1 to 422
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610037M15Rik
    • 6720408I04Rik
    • Acylglycerol kinase mitochondrial
    • Acylglycerol kinase, mitochondrial
    • agk
    • AGK_HUMAN
    • AI465370
    • FLJ10842
    • hAGK
    • HsMuLK
    • MuLK
    • Multi substrate lipid kinase
    • Multi-substrate lipid kinase
    • Multiple substrate lipid kinase
    • RGD1562046
    see all
  • Function
    Lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. Does not phosphorylate sphingosine. Overexpression increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.
  • Tissue specificity
    Highly expressed in muscle, heart, kidney and brain.
  • Pathway
    Lipid metabolism; glycerolipid metabolism.
  • Sequence similarities
    Contains 1 DAGKc domain.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab163203 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up