Recombinant Human Acyltransferase like 1 protein (ab162907)

Overview

  • Product name
    Recombinant Human Acyltransferase like 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQI GSARRVQIVLLGIILLPIRVLLVALILLLAWPFAAISTVCCPEKLTHPIT GWRRKITQTALKFLGRAMFFSMGFIVAVKGKIASPLEAPVFVAAPHSTFF DGIACVVAGLPSMVSRNENAQVPLIGRLLRAVQPVLVSRVDPDSRKNTIN EIIKRTTSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPGVPVQPVLLRY PNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPV LFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKIS RKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLF ALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITE EEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIF TTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD
    • Amino acids
      1 to 544
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 acylglycerophosphocholine O acyltransferase
    • 1 alkylglycerophosphocholine O acetyltransferase
    • 1-acylglycerophosphocholine O-acyltransferase
    • 1-alkylglycerophosphocholine O-acetyltransferase
    • A330042H22
    • Acetyl CoA:lyso PAF acetyltransferase
    • Acetyl-CoA:lyso-PAF acetyltransferase
    • Acetyl-CoA:lyso-platelet-activating factor acetyltransferase
    • acyl CoA:lysophosphatidylcholine acyltransferase 2
    • Acyl-CoA:lysophosphatidylcholine acyltransferase member 1
    • Acyltransferase like 1A
    • Acyltransferase-like 1
    • AYTL1
    • Aytl1a
    • DKFZp686H22112
    • FLJ20481
    • lpafat1
    • LPC acyltransferase 2
    • LPCAT-2
    • LPCAT2
    • Lyso PAF acetyltransferase
    • Lyso platelet activating factor (PAF) acetyltransferase
    • Lyso-PAF acetyltransferase
    • LysoPAFAT
    • LysoPAFAT/LPCAT2
    • LysoPC acyltransferase 2
    • Lysophosphatidylcholine acyltransferase 2
    • OTTMUSP00000029641
    • PCAT2_HUMAN
    • RGD1563994
    see all
  • Function
    Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-dependent. Involved in platelet-activating factor (PAF) biosynthesis by catalyzing the conversion of the PAF precursor, 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) into 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (PAF). Also converts lyso-PAF to 1-alkyl-phosphatidylcholine (PC), a major component of cell membranes and a PAF precursor. Under resting conditions, acyltransferase activity is preferred. Upon acute inflammatory stimulus, acetyltransferase activity is enhanced and PAF synthesis increases.
  • Pathway
    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities
    Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
    Contains 2 EF-hand domains.
  • Domain
    The HXXXXD motif is essential for acyltransferase activity.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab162907 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up