Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHT QAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHID KANFNNEKVILKLDYSDFQIVK
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 99
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105127 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Acylphosphatase
    • Acylphosphatase 1
    • Acylphosphatase 1 erythrocyte (common) type
    • Acylphosphatase 1 erythrocyte type
    • Acylphosphatase erythrocyte isozyme
    • Acylphosphatase organ common type isozyme
    • Acylphosphatase-1
    • Acylphosphatase1
    • Acylphosphate phosphohydrolase 1
    • ACYP 1
    • ACYP1
    • ACYP1_HUMAN
    • ACYPE
    • Erythrocyte acylphosphatase 1
    • erythrocyte isozyme
    • organ-common type isozyme
    see all
  • Function
    Its physiological role is not yet clear.
  • Tissue specificity
    Organ-common type isozyme is found in many different tissues.
  • Sequence similarities
    Belongs to the acylphosphatase family.
    Contains 1 acylphosphatase-like domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab105127 at approximately 13.6kDa (3µg).

References

ab105127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up