Overview

  • Product name
    Recombinant Human ADA2a protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF EYKKHRSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVAN QMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTD DPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDIL HALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDL YETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFY VKFYK
    • Amino acids
      1 to 305
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADA2
    • ADA2 ALPHA
    • ADA2 like
    • ADA2 like protein
    • ADA2, yeast, homolog of, alpha
    • ADA2A
    • hADA2
    • KL04P
    • Tada2l
    • Transcriptional adapter 2 alpha
    • Transcriptional adapter 2 like
    • Transcriptional adaptor 2 (ADA2 homolog, yeast) like
    • Transcriptional adaptor 2 (ADA2, yeast, homolog) like
    • Transcriptional adaptor 2 alpha
    • Transcriptional adaptor 2A
    see all
  • Relevance
    Many DNA binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. ADA2a is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex.
  • Cellular localization
    Nuclear, Chromosome

Images

  • ab159622 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up