Recombinant Human ADAL protein (denatured) (ab180314)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSEFMIEAEEQQPCKTDFYSELPKVELHA HLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQ LTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESI LEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVL GLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDL LPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 267
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_001012987

Specifications

Our Abpromise guarantee covers the use of ab180314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • 4930578F03Rik
    • ADAL
    • ADAL_HUMAN
    • Adenosine deaminase like
    • Adenosine deaminase-like protein
    • DKFZp313B2137
    • FLJ44620
    • MGC62428
    • MGC63264
    • RP23-232N20.3
    see all
  • Function
    Putative nucleoside deaminase. May catalyze the hydrolytic deamination of adenosine or some similar substrate and play a role in purine metabolism.
  • Sequence similarities
    Belongs to the adenosine and AMP deaminases family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180314 (3 µg).

References

ab180314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up