Recombinant Human ADAM11 protein (ab158869)

Overview

  • Product name
    Recombinant Human ADAM11 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKE QLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHL FSGR
    • Amino acids
      230 to 333
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase domain 11
    • ADA11_HUMAN
    • ADAM 11
    • Adam11
    • and cysteine-rich protein
    • Disintegrin and metalloproteinase domain-containing protein 11
    • disintegrin-like
    • MDC
    • Metalloproteinase like, disintegrin like, and cysteine rich protein
    • Metalloproteinase-like
    see all
  • Function
    Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein.
  • Tissue specificity
    Expressed predominantly in brain. Slightly detected or not at all in other tissues.
  • Sequence similarities
    Contains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • Domain
    A conserved motif [AVN[ED]CD] within the disintegrin-like domain could be involved in the binding to the integrin receptor.
  • Post-translational
    modifications
    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158869 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up