Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIV IEGKPYTVNLMQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEG YPKSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADV SLYNEKDIESRDLSFKLQSVEYNHMGSDTTVVAQKVFQLIGLTNAIFVSF NITIILSSLELWIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLL VYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVILAQLLSLSM GITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFAHFISKQKSQ CLHNQPRLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATC RFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENH YVQTGHPCGLNQWICIDGVCMSGDKQCTDTFGKEVEFGPSECYSHLNSKT DVSGNCGISDSGYTQCEADNLQCGKLICKYVGKFLLQIPRATIIYANISG HLCIAVEFASDHADSQKMWIKDGTSCGSNKVCRNQRCVSSSYLGYDCTTD KCNDRGVCNNKKHCHCSASYLPPDCSVQSDLWPGGSIDSGNFPPVAIPAR LPERRYIENIYHSKPMRWPFFLFIPFFIIFCVLIAIMVKVNFQRKKWRTE DYSSDEQPESESEPKG
    • Molecular weight
      105 kDa including tags
    • Amino acids
      1 to 716

Specifications

Our Abpromise guarantee covers the use of ab117063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase domain 2
    • ADAM 2
    • ADAM metallopeptidase domain 2
    • Adam2
    • ADAM2_HUMAN
    • AI323749
    • Cancer/testis antigen 15
    • CRYN1
    • CRYN2
    • CT15
    • Disintegrin and metalloproteinase domain-containing protein 2
    • Fertilin beta
    • Fertilin subunit beta
    • Ftnb
    • PH 30
    • PH 30b
    • PH-30
    • PH30
    • Ph30 beta
    • PH30-beta
    see all
  • Function
    Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein.
  • Tissue specificity
    Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
  • Sequence similarities
    Contains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • Domain
    A tripeptide motif (FEE) within disintegrin-like domain could be involved in the binding to egg integrin receptor and thus could mediate sperm/egg binding.
  • Post-translational
    modifications
    The prodomain and the metalloprotease domain are cleaved during the epididymal maturation of the spermatozoa.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117063 at approximately 104.76 kDa.
    Stained with Coomassie Blue.

References

ab117063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up