Recombinant Human ADAM23 protein (ab125993)

Overview

  • Product name
    Recombinant Human ADAM23 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKC SILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECY GLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTG DSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKF CYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQ GEIIPTSFYHQGRVIDCSGAHVVLDDDTDVG
    • Amino acids
      426 to 706
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab125993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.2% Guanidine HCl

  • Reconstitution
    Reconstitute with water to desired concentration.it is suggested to dissolve directly in 250ul DDW and the final concentration is 0.2ug/ul.

General Info

  • Alternative names
    • A disintegrin and metalloproteinase domain 23
    • ADAM metallopeptidase domain 23
    • Disintegrin and metalloproteinase domain containing protein 23
    • MDC 3
    • MDC3
    • Metalloproteinase like disintegrin like and cysteine rich protein 3
    see all
  • Relevance
    ADAM23 is a non-catalytic metalloprotease-like protein. It is highly expressed in the brain, primarily in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole, and weakly expressed in the heart. 3 isoforms are produced by alternative splicing, alpha, beta and gamma. ADAM23 may play a role in cell-cell and cell-matrix interactions.
  • Cellular localization
    Single pass type I membrane protein. 3 isoforms produced by alternative splicing, gamma isoform is secreted.

References for Recombinant Human ADAM23 protein (ab125993)

ab125993 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up