Recombinant Human ADAM29 protein (ab161290)

Overview

  • Product name
    Recombinant Human ADAM29 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLET VHTKDIFNVK
    • Amino acids
      339 to 398
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase domain 29
    • ADA29_HUMAN
    • ADAM 29
    • ADAM metallopeptidase domain 29
    • ADAM29
    • Cancer/testis antigen 73
    • CT73
    • Disintegrin and metalloproteinase domain-containing protein 29
    • Metallaproteinase disintegrin (ADAM29)
    • svph1
    see all
  • Function
    May be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein.
  • Tissue specificity
    Expressed specifically in testes.
  • Sequence similarities
    Contains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161290 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up