Overview

  • Product name
    Recombinant Human ADAM5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQTSILIKSSCRPQFQRRFHHRMQKQIQNIISILSSASVINSYDENDIRH SKPLLVQMDCNYNGYVAGIPNSLVTLSVCSGLRGTMQLKNISYGIEPMEA VSGFIHKIYEEKYADTNILLEENDTYTWFNSEYQVRKSSEKTDFIKLFPR YIEMHIVVDKNLFKPANMICRKSVGKECDFTEYCNGDLPYCLPDTYVRDG EYCDSGGAFCFQGKCRTFDKQCDDLIGRGSRGAPVFCYDEINTRGDNFGN CGTAHCLFQHILCGKLVCTWEHRDLISRPNLSVIYAHVRDQTCVSTYLPR RTPPPVNSPISITSYYSAEDRDETFVQDGSMCGPDMYCFEMHCKHVRFLM NLKLCDASNHCDRHGVCNNFNHCHCEKGYNPPYCQPKQGAFGSIDDGHLV PPTERSYMEEGR
    • Amino acids
      1 to 412
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADAM metallopeptidase domain 5, pseudogene
    • ADAM5P
    • Putative disintegrin and metalloproteinase domain-containing protein 5
    • Putative transmembrane metalloproteinase like, disintegrin like, and cysteine rich protein II
    • tMDC II
    • TMDC2
    • TMDCII
    see all
  • Relevance
    ADAM5 is putatively a non catalytic metalloprotease-like protein which is highly expressed in testis. ADAM5 contains 1 disintegrin domain and 1 EGF-like domain.

Images

  • ab166055 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up