Overview

  • Product name
    Recombinant Human ADAM9 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNK DLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFG
    • Amino acids
      36 to 135
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase domain 9
    • ADAM 9
    • ADAM metallopeptidase domain 9
    • Cellular disintegrin related protein
    • Cone rod dystrophy 9
    • CORD9
    • Disintegrin and metalloproteinase domain 9
    • Disintegrin and metalloproteinase domain containing protein 9
    • KIAA0021
    • MCMP
    • MDC 9
    • MDC9
    • Meltrin gamma
    • Metalloprotease disintegrin cysteine rich protein 9
    • Mltng
    • Myeloma cell metalloproteinase
    see all
  • Relevance
    ADAM9 encodes disintegrin and metalloprotease (ADAM) domain 9, which is a member of the ADAM protein family. Members of this family are membrane- anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell- cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The member encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor.
  • Cellular localization
    Isoform 1: Cell membrane; single-pass type I membrane protein. Isoform 2: Secreted protein.

Images

  • ab160173 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up