Recombinant Human ADAMTS12 protein (ab164362)

Overview

  • Product name
    Recombinant Human ADAMTS12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLP EYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEK DLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGT RVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKV PETKEPTCGLKGIVTHMSSWVEESVLFFW
    • Amino acids
      1 to 229
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase with thrombospondin motifs 12
    • A disintegrin like and metalloprotease with thrombospondin type 1 motif 12
    • ADAM metallopeptidase with thrombospondin type 1 motif 12
    • ADAM TS 12
  • Relevance
    This protein is a disintegrin and metalloproteinase with thrombospondin motifs 12 (ADAMTS12), which is a member of the ADAMTS protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin like domain, and a thrombospondin type 1 (TS 1) motif. Individual members of this family differ in the number of C terminal TS 1 motifs, and some have unique C terminal domains. The enzyme encoded by this gene contains 8 TS 1 motifs. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion.
  • Cellular localization
    Secreted

Images

  • ab164362 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up